Zwiększona ekspresja receptora C5a w sepsie

Nadmierna produkcja produktu aktywacji dopełniacza C5a wydaje się być szkodliwa podczas rozwoju sepsy u gryzoni. Niewiele wiadomo na temat roli receptora C5a (C5aR) i jego obecności w różnych narządach podczas sepsy. Stosując model podwiązania / przebicia stolca (CLP) u myszy, wykazaliśmy tutaj, że immunoreaktywność C5aR była uderzająco zwiększona we wczesnym stadium sepsy w płucach, wątrobie, nerkach i sercu, zarówno u myszy kontrolnych, jak iu myszy z niedoborem neutrofili. Ekspresja mRNA C5aR w tych narządach była również znacznie zwiększona podczas sepsy. Analiza immunohistochemiczna ujawniła wzorce zwiększonej ekspresji C5aR w komórkach miękiszowych we wszystkich czterech narządach według CLP. Myszy, którym wstrzyknięto na początku CLP blokującą IgG do C5aR (a C5aR) wykazały znacznie poprawioną przeżywalność w porównaniu ze zwierzętami otrzymującymi niespecyficzne IgG, podobnie jak myszy, którym wstrzyknięto A5a. U myszy leczonych C5aR, poziomy IL-6 i TNF-a w surowicy krwi a liczba bakterii w różnych narządach była istotnie zmniejszona podczas CLP w porównaniu ze zwierzętami kontrolnymi z CLP. Badania te wykazują po raz pierwszy, że C5aR ulega podwyższeniu w płucach, wątrobie, nerkach i sercu we wczesnych fazach sepsy i że blokada C5aR jest silnie ochronna przed letalnym wynikiem sepsy. Wstęp We wczesnych fazach sepsy wykazano, że produkt aktywacji dopełniacza C5a odgrywa ważną rolę zapalną u gryzoni po podwiązaniu i przebiciu w kale (CLP) lub po wlewie LPS (1. 5). Poza silną aktywnością chemotaktyczną znane są inne efekty C5a: uwalnianie z komórek fagocytujących z ziarnistych enzymów, wytwarzanie w neutrofilach anionu ponadtlenkowego, uwalnianie histaminy z komórek tucznych, rozszerzanie naczyń krwionośnych, zwiększona przepuszczalność naczyń, skurcz mięśni gładkich i indukcja apoptozy tymocytów podczas sepsa (3, 6-10). Reakcje na C5a są mediowane przez wrażliwy na białko G wrażliwy siedmio-transbłonowy receptor C5a G (C5aR), który należy do nadrodziny receptorów typu rodopsyny (11, 12). Początkowo uznawano, że C5aR ogranicza się do komórek szpikowych (13). W ostatnich latach wykazano, że C5aR jest obecny na różnych komórkach w wielu różnych narządach (wątroba, nerki, płuca, mózg) (14. 19) i na komórkach T (20). Nadmierna produkcja C5a podczas sepsy wiąże się z. Dezaktywacją. z krwinek białych obojętnochłonnych, co powoduje utratę masy oddechowej i obumarcie drogi życiowej zależnej od tlenu w celu zabicia fagocytowanych bakterii (1). Biorąc pod uwagę znaczenie C5a podczas sepsy u gryzoni, przewidywano, że rola C5aR w sepsie będzie ważna, ale nie została jeszcze wykazana. Ponadto mało wiadomo na temat funkcjonalnego znaczenia C5aR na komórkach nie-mezoidalnych. Dlatego badaliśmy zawartość C5aR w płucach, wątrobie, nerkach i sercu, przed iw trakcie wczesnego okresu sepsy, stosując badania wiązania in vivo z użyciem przeciwciała 125I przeciw mysiej C5aR, analizę RT-PCR dla mRNA C5aR i barwienie immunohistochemiczne. odcinków tkanek. Ponadto, badaliśmy na myszach z CLP działanie anty-C5aR (a C5aR) na zawartość cytokin w surowicy i na liczbę kolonii bakteryjnych w różnych narządach. Dane, które należy przedstawić, pokazują, że C5aR jest znacząco podwyższony w czasie sepsy i że jego blokada radykalnie poprawia przeżycie w sepsie, zmniejsza poziomy cytokin w surowicy i znacznie zmniejsza zawartość bakterii w narządach. Metody Synteza peptydu i wytwarzanie przeciwciał przeciw A5aR. 37-aminokwasowy peptyd obejmujący N-koniec mysiego C5aR i jedną dodatkową cysteinę (MDPIDNSSFEINYDHYGTMDPNIPADGIHLPKRQPGDC) zsyntetyzowano za pomocą syntetyzera peptydów 430A Applied Biosystems (Foster City, California, USA), jak opisano wcześniej (21). Peptyd połączono następnie z hemocyjaniną skałoczepa metodą aldehydu glutarowego i zastosowano do immunizacji królików i wytwarzania immunoreaktywnych surowic odpornościowych. Przeciwciało swoiste wobec antypeptydu oczyszczono metodą chromatografii powinowactwa, stosując syntetyczny peptyd sprzężony z aktywowanym bromocyjanem Sepharose 4B (Pharmacia Biotech Inc., Piscataway, New Jersey, USA). Wytwarzanie przeciwciała a C5a. Koniec C-końcowy (reszty aminokwasowe 58 (77) szczurzej cząsteczki C5a wybrano jak opisano poprzednio (5). Peptyd połączono z hemocyjaniną skałoczepa (patrz wyżej), a następnie zastosowano do immunizacji kóz i produkcji surowic odpornościowych. Przeciwciało specyficzne wobec przeciw-peptydu było oczyszczone za pomocą powinowactwa. Jego reaktywność krzyżowa z rekombinowanym mysim C5a została potwierdzona w analizie Western. Początkowa aktywność in vivo tego przeciwciała została potwierdzona przez odkrycie zmniejszonego uszkodzenia płuc indukowanego przez kompleks immunologiczny IgG u myszy w porównaniu ze zwierzętami, którym wstrzyknięto IgG kontrolne (dane nie przedstawione). Klonowanie i ekspresja myszy C5a
[podobne: osłabienie organizmu przyczyny, olej z konopii indyjskiej, maciej zagłoba zygler ]
[więcej w: jacek bryndal, klaudia el dursi, 5lo bydgoszcz ]